Gastrin Peptide (Chicken)

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-1357	1mg	440.00	- +	+ Add to cart

Product description

Gastrin stimulates the stomach mucosa to produce hydrochloric acid and the pancreas to secrete digestive enzymes. Gastrin also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine. Progastrin is processed in two major bioactive gastrins, gastrin-17 and gastrin-34.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Synonyms	Gastrin; gastrin-17; G17; gastrin component III; GAST; GAS; cholecystokinin-like peptide; antral peptide
Sequence	H-Phe-Leu-Pro-His-Val-Phe-Ala-Glu-Leu-Ser-Asp-Arg-Lys-Gly-Phe-Val-Gln-Gly-Asn-Gly-Ala-Val-Glu-Ala-Leu-His-Asp-Phe-Tyr-Pro-Asp-Trp-Met-Asp-Phe-NH2 or H-FLPHVFAELSDRKGFVQGNGAVEALHDFYPDWMDF-NH2
Molecular Formula	C190H265N47O51S1
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of Gastrin Peptide (Chicken)